AKR1A1 (NM_153326) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202813] |
Predicted MW | 36.6 kDa |
Protein Sequence |
Protein Sequence
>RC202813 protein sequence
Red=Cloning site Green=Tags(s) MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_697021 |
RefSeq Size | 1469 |
RefSeq ORF | 975 |
Synonyms | ALDR1; ALR; ARM; DD3; HEL-S-6 |
Locus ID | 10327 |
UniProt ID | P14550 |
Cytogenetics | 1p34.1 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300302 | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057) | 10 ug |
$3,255.00
|
|
LC401826 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407047 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401826 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 | 100 ug |
$436.00
|
|
LY407047 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2 | 100 ug |
$436.00
|
|
TP300302 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP302813 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.