SULT1C2 (NM_001056) Human Mass Spec Standard

SKU
PH302775
SULT1C2 MS Standard C13 and N15-labeled recombinant protein (NP_001047)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202775]
Predicted MW 34.9 kDa
Protein Sequence
Protein Sequence
>RC202775 protein sequence
Red=Cloning site Green=Tags(s)

MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEK
CQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSY
YHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQ
FMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI
YRRKMEGTSINFCMEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001047
RefSeq Size 2799
RefSeq ORF 888
Synonyms humSULTC2; ST1C1; ST1C2; SULT1C1
Locus ID 6819
UniProt ID O00338
Cytogenetics 2q12.3
Summary Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SULT1C2 (NM_001056) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420736 SULT1C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420736 Transient overexpression lysate of sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1 100 ug
$436.00
TP302775 Recombinant protein of human sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720937 Purified recombinant protein of Human sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.