CAPZA2 (NM_006136) Human Mass Spec Standard

SKU
PH302764
CAPZA2 MS Standard C13 and N15-labeled recombinant protein (NP_006127)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202764]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC202764 protein sequence
Red=Cloning site Green=Tags(s)

MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGY
EDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGV
CTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHK
DIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
KEMQNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006127
RefSeq Size 2373
RefSeq ORF 858
Synonyms CAPPA2; CAPZ
Locus ID 830
UniProt ID P47755
Cytogenetics 7q31.2
Summary The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CAPZA2 (NM_006136) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416843 CAPZA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416843 Transient overexpression lysate of capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2) 100 ug
$436.00
TP302764 Recombinant protein of human capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761515 Purified recombinant protein of Human capping protein (actin filament) muscle Z-line, alpha 2 (CAPZA2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.