OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Surb7 (MED21) (NM_004264) Human Mass Spec Standard

Be the first to review this product
SKU
PH302763
MED21 MS Standard C13 and N15-labeled recombinant protein (NP_004255)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314905 Rabbit polyclonal anti-MED21 antibody
100 ul
$380.00
LY418106 Transient overexpression lysate of mediator complex subunit 21 (MED21) (as WB positive control) 100 ug
$436.00

Other products for "Surb7 or NM_004264"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202763
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC202763 protein sequence
Red=Cloning site Green=Tags(s)

MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS
LPDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004255
RefSeq Size 2705
RefSeq ORF 432
Synonyms hSrb7; SRB7; SURB7
Locus ID 9412
UniProt ID Q13503
Cytogenetics 12p11.23
Summary This gene encodes a member of the mediator complex subunit 21 family. The encoded protein interacts with the human RNA polymerase II holoenzyme and is involved in transcriptional regulation of RNA polymerase II transcribed genes. A pseudogene of this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2012
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Surb7" proteins (3)
SKU Description Size Price
LC418106 Lyophilized MED21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418106 Transient overexpression lysate of mediator complex subunit 21 (MED21) (as WB positive control) 100 ug
$436.00
TP302763 Recombinant protein of human mediator complex subunit 21 (MED21), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products