Troponin C (TNNC2) (NM_003279) Human Mass Spec Standard

SKU PH302754

TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202754]
• Predicted MW: 18.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC202754 protein sequence; Red=Cloning site Green=Tags(s); ; MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT; IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD; KNNDGRIDFDEFLKMMEGVQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003270
• RefSeq Size: 698
• RefSeq ORF: 480
• Synonyms: CFAP85; FAP85
• Locus ID: 7125
• UniProt ID: P02585
• Cytogenetics: 20q13.12
• Summary: Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. [provided by RefSeq, Jul 2008]
• Protein Pathways: Calcium signaling pathway