FABP3 (NM_004102) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202737] |
Predicted MW | 14.9 kDa |
Protein Sequence |
Protein Sequence
>RC202737 protein sequence
Red=Cloning site Green=Tags(s) MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004093 |
RefSeq Size | 1097 |
RefSeq ORF | 399 |
Synonyms | FABP11; H-FABP; M-FABP; MDGI; O-FABP |
Locus ID | 2170 |
UniProt ID | P05413 |
Cytogenetics | 1p35.2 |
Summary | The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Protein Pathways | PPAR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC418213 | FABP3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418213 | Transient overexpression lysate of fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3) | 100 ug |
$436.00
|
|
TP302737 | Recombinant protein of human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3), 20 µg | 20 ug |
$737.00
|
|
TP720116 | Recombinant protein of human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3) | 10 ug |
$265.00
|
|
TP750160 | Purified recombinant protein of Human leptin (LEP),Val22-end, tag free, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
TP790065 | Purified recombinant protein of Human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3), with N-terminal HIS tag, expressed in HEK293, 50ug | 50 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.