PAIP1 (NM_182789) Human Mass Spec Standard

SKU
PH302735
PAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_877590)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202735]
Predicted MW 45.6 kDa
Protein Sequence
Protein Sequence
>RC202735 protein sequence
Red=Cloning site Green=Tags(s)

MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYE
DGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGA
RLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQ
VTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCS
RDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLER
EDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_877590
RefSeq Size 2559
RefSeq ORF 1200
Locus ID 10605
UniProt ID Q9H074
Cytogenetics 5p12
Summary The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PAIP1 (NM_182789) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405243 PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405357 PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405243 Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 3 100 ug
$436.00
LY405357 Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2 100 ug
$436.00
TP302735 Recombinant protein of human poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.