OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLIC3 (NM_004669) Human Mass Spec Standard

Be the first to review this product
SKU
PH302726
CLIC3 MS Standard C13 and N15-labeled recombinant protein (NP_004660)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308675 Rabbit polyclonal antibody to CLIC3 (chloride intracellular channel 3)
100 ul
$665.00
LY417836 Transient overexpression lysate of chloride intracellular channel 3 (CLIC3) (as WB positive control) 100 ug
$436.00

Other products for "CLIC3 or NM_004669"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202726
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC202726 protein sequence
Red=Cloning site Green=Tags(s)

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD
AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS
YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM
QEKEFKYTCPHSAEILAAYRPAVHPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004660
RefSeq Size 813
RefSeq ORF 708
Locus ID 9022
UniProt ID O95833
Cytogenetics 9q34.3
Summary Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLIC3" proteins (4)
SKU Description Size Price
LC417836 Lyophilized CLIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417836 Transient overexpression lysate of chloride intracellular channel 3 (CLIC3) (as WB positive control) 100 ug
$436.00
TP302726 Recombinant protein of human chloride intracellular channel 3 (CLIC3), 20 µg 20 ug
$867.00
TP720996 Purified recombinant protein of Human chloride intracellular channel 3 (CLIC3) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products