Carboxypeptidase A2 (CPA2) (NM_001869) Human Mass Spec Standard

SKU
PH302719
CPA2 MS Standard C13 and N15-labeled recombinant protein (NP_001860)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202719]
Predicted MW 46.8 kDa
Protein Sequence
Protein Sequence
>RC202719 protein sequence
Red=Cloning site Green=Tags(s)

MRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFV
NVQAVKVFLGSQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPG
LVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDA
LDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANS
EVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGP
ICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001860
RefSeq Size 1342
RefSeq ORF 1251
Locus ID 1358
UniProt ID P48052
Cytogenetics 7q32.2
Summary Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues and is a secreted protein. [provided by RefSeq, Dec 2008]
Protein Families Druggable Genome, Protease, Secreted Protein
Write Your Own Review
You're reviewing:Carboxypeptidase A2 (CPA2) (NM_001869) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419697 CPA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419697 Transient overexpression lysate of carboxypeptidase A2 (pancreatic) (CPA2) 100 ug
$436.00
TP302719 Recombinant protein of human carboxypeptidase A2 (pancreatic) (CPA2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720477 Recombinant protein of human carboxypeptidase A2 (pancreatic) (CPA2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.