OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSMB (NM_002443) Human Mass Spec Standard

Be the first to review this product
SKU
PH302704
MSMB MS Standard C13 and N15-labeled recombinant protein (NP_002434)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501072 Anti-MSMB mouse monoclonal antibody, clone OTI6C7 (formerly 6C7) 100 ul
$447.00
LY400872 Transient overexpression lysate of microseminoprotein, beta- (MSMB), transcript variant PSP94 (as WB positive control) 100 ug
$436.00

Other products for "MSMB or NM_002443"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202704
Predicted MW 12.9 kDa
Protein Sequence
Protein Sequence
>RC202704 protein sequence
Red=Cloning site Green=Tags(s)

MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC
TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002434
RefSeq Size 503
RefSeq ORF 342
Synonyms HPC13; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP-94; PSP57; PSP94
Locus ID 4477
UniProt ID P08118
Cytogenetics 10q11.22
Summary The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. provided by RefSeq, Jul 2008
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSMB" proteins (3)
SKU Description Size Price
LC400872 Lyophilized MSMB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400872 Transient overexpression lysate of microseminoprotein, beta- (MSMB), transcript variant PSP94 (as WB positive control) 100 ug
$436.00
TP302704 Recombinant protein of human microseminoprotein, beta- (MSMB), transcript variant PSP94, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products