OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FKBP14 (NM_017946) Human Mass Spec Standard

Be the first to review this product
SKU
PH302674
FKBP14 MS Standard C13 and N15-labeled recombinant protein (NP_060416)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358222 FKBP14 Antibody - C-terminal region
100 ul
$585.00
LY413430 Transient overexpression lysate of FK506 binding protein 14, 22 kDa (FKBP14) (as WB positive control) 100 ug
$436.00

Other products for "FKBP14 or NM_017946"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202674
Predicted MW 24.2 kDa
Protein Sequence
Protein Sequence
>RC202674 protein sequence
Red=Cloning site Green=Tags(s)

MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN
NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS
HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060416
RefSeq Size 5086
RefSeq ORF 633
Synonyms EDSKMH; EDSKSCL2; FKBP22; IPBP12
Locus ID 55033
UniProt ID Q9NWM8
Cytogenetics 7p14.3
Summary The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. provided by RefSeq, Mar 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FKBP14" proteins (3)
SKU Description Size Price
LC413430 Lyophilized FKBP14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413430 Transient overexpression lysate of FK506 binding protein 14, 22 kDa (FKBP14) (as WB positive control) 100 ug
$436.00
TP302674 Recombinant protein of human FK506 binding protein 14, 22 kDa (FKBP14), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products