MED4 (NM_014166) Human Mass Spec Standard

SKU
PH302663
MED4 MS Standard C13 and N15-labeled recombinant protein (NP_054885)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202663]
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC202663 protein sequence
Red=Cloning site Green=Tags(s)

MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI
HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK
GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG
RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054885
RefSeq Size 2287
RefSeq ORF 810
Synonyms ARC36; DRIP36; HSPC126; TRAP36; VDRIP
Locus ID 29079
UniProt ID Q9NPJ6
Cytogenetics 13q14.2
Summary This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:MED4 (NM_014166) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415456 MED4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415456 Transient overexpression lysate of mediator complex subunit 4 (MED4) 100 ug
$436.00
TP302663 Recombinant protein of human mediator complex subunit 4 (MED4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.