PUS1 (NM_001002019) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202637] |
Predicted MW | 44.4 kDa |
Protein Sequence |
Protein Sequence
>RC202637 protein sequence
Red=Cloning site Green=Tags(s) MAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERREKPPKRKIVLLMAYSGKGYH GMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILE KINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLAC YKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGY APESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTII GTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001002019 |
RefSeq Size | 1637 |
RefSeq ORF | 1197 |
Synonyms | MLASA1 |
Locus ID | 80324 |
UniProt ID | Q9Y606 |
Cytogenetics | 12q24.33 |
Summary | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300879 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) | 10 ug |
$3,255.00
|
|
PH322753 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020) | 10 ug |
$3,255.00
|
|
LC410839 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424322 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424323 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410839 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 | 100 ug |
$436.00
|
|
LY424322 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 | 100 ug |
$436.00
|
|
LY424323 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 | 100 ug |
$436.00
|
|
TP300879 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP302637 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP322753 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.