PUS1 (NM_001002019) Human Mass Spec Standard

SKU
PH302637
PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002019)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202637]
Predicted MW 44.4 kDa
Protein Sequence
Protein Sequence
>RC202637 protein sequence
Red=Cloning site Green=Tags(s)

MAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERREKPPKRKIVLLMAYSGKGYH
GMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILE
KINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLAC
YKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGY
APESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTII
GTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002019
RefSeq Size 1637
RefSeq ORF 1197
Synonyms MLASA1
Locus ID 80324
UniProt ID Q9Y606
Cytogenetics 12q24.33
Summary This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:PUS1 (NM_001002019) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300879 PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) 10 ug
$3,255.00
PH322753 PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020) 10 ug
$3,255.00
LC410839 PUS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424322 PUS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424323 PUS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410839 Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 100 ug
$436.00
LY424322 Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 100 ug
$436.00
LY424323 Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 100 ug
$436.00
TP300879 Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1, 20 µg 20 ug
$737.00
TP302637 Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2, 20 µg 20 ug
$737.00
TP322753 Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.