DHRS7B (NM_015510) Human Mass Spec Standard

SKU
PH302625
DHRS7B MS Standard C13 and N15-labeled recombinant protein (NP_056325)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202625]
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC202625 protein sequence
Red=Cloning site Green=Tags(s)

MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAK
VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILV
NNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAAS
KHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAV
GKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056325
RefSeq Size 1841
RefSeq ORF 975
Synonyms CGI-93; SDR32C1
Locus ID 25979
UniProt ID Q6IAN0
Cytogenetics 17p11.2
Summary This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:DHRS7B (NM_015510) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414503 DHRS7B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414503 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 7B (DHRS7B) 100 ug
$436.00
TP302625 Recombinant protein of human dehydrogenase/reductase (SDR family) member 7B (DHRS7B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.