SUSD4 (NM_001037175) Human Mass Spec Standard

SKU
PH302622
SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202622]
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC202622 protein sequence
Red=Cloning site Green=Tags(s)

MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP
SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG
EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC
FPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTC
SSTSTTTSLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032252
RefSeq Size 1114
RefSeq ORF 870
Synonyms PRO222
Locus ID 55061
UniProt ID Q5VX71
Cytogenetics 1q41
Summary Acts as complement inhibitor by disrupting the formation of the classical C3 convertase. Isoform 3 inhibits the classical complement pathway, while membrane-bound isoform 1 inhibits deposition of C3b via both the classical and alternative complement pathways.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SUSD4 (NM_001037175) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413412 SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421931 SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413412 Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 1 100 ug
$665.00
LY421931 Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 2 100 ug
$436.00
TP302622 Recombinant protein of human sushi domain containing 4 (SUSD4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.