OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF4A3 (NM_014740) Human Mass Spec Standard

Be the first to review this product
SKU
PH302567
EIF4A3 MS Standard C13 and N15-labeled recombinant protein (NP_055555)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370180 EIF4A3 rabbit polyclonal antibody
100 ul
$310.00
LY402368 Transient overexpression lysate of eukaryotic translation initiation factor 4A, isoform 3 (EIF4A3) (as WB positive control) 100 ug
$436.00

Other products for "EIF4A3 or NM_014740"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202567
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC202567 protein sequence
Red=Cloning site Green=Tags(s)

MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK
QIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC
IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP
ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA
VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055555
RefSeq Size 1734
RefSeq ORF 1233
Synonyms DDX48; eIF-4A-III; eIF4A-III; eIF4AIII; Fal1; MUK34; NMP265; NUK34; RCPS
Locus ID 9775
UniProt ID P38919
Cytogenetics 17q25.3
Summary This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF4A3" proteins (3)
SKU Description Size Price
LC402368 Lyophilized EIF4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402368 Transient overexpression lysate of eukaryotic translation initiation factor 4A, isoform 3 (EIF4A3) (as WB positive control) 100 ug
$436.00
TP302567 Recombinant protein of human eukaryotic translation initiation factor 4A, isoform 3 (EIF4A3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products