OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACTR1B (NM_005735) Human Mass Spec Standard

Be the first to review this product
SKU
PH302493
ACTR1B MS Standard C13 and N15-labeled recombinant protein (NP_005726)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340074 Rabbit Polyclonal Anti-ACTR1B Antibody
100 ul
$585.00
LY417103 Transient overexpression lysate of ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (as WB positive control) 100 ug
$436.00

Other products for "ACTR1B or NM_005735"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202493
Predicted MW 42.3 kDa
Protein Sequence
Protein Sequence
>RC202493 protein sequence
Red=Cloning site Green=Tags(s)

MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLT
IRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFIS
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAE
FEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVA
FAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASL
DTFKKMWVSKKEYEEDGSRAIHRKTF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005726
RefSeq Size 2258
RefSeq ORF 1128
Synonyms ARP1B; CTRN2; PC3
Locus ID 10120
UniProt ID P42025
Cytogenetics 2q11.2
Summary This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. provided by RefSeq, Aug 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACTR1B" proteins (3)
SKU Description Size Price
LC417103 Lyophilized ACTR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417103 Transient overexpression lysate of ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (as WB positive control) 100 ug
$436.00
TP302493 Recombinant protein of human ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products