OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TLE2 (NM_003260) Human Mass Spec Standard

Be the first to review this product
SKU
PH302474
TLE2 MS Standard C13 and N15-labeled recombinant protein (NP_003251)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504240 TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6) 100 ul
$447.00
LY428507 Transient overexpression lysate of transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) (TLE2), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "TLE2 or NM_003260"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202474
Predicted MW 79.8 kDa
Protein Sequence
Protein Sequence
>RC202474 protein sequence
Red=Cloning site Green=Tags(s)

MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGL
NIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTP
RPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESLVEEERPSGPG
GGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLG
SPLPRAKELILNDLPASTPASKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFT
TSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGA
KTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAK
VCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQQHDFS
SQIFSLGHCPNQDWLAVGMESSNVEILHVRKPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRT
PYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003251
RefSeq Size 2722
RefSeq ORF 2229
Synonyms ESG; ESG2; GRG2
Locus ID 7089
UniProt ID Q04725
Cytogenetics 19p13.3
Summary Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TLE2" proteins (5)
SKU Description Size Price
LC401124 Lyophilized TLE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428507 Lyophilized TLE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401124 Transient overexpression lysate of transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) (TLE2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428507 Transient overexpression lysate of transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) (TLE2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302474 Recombinant protein of human transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) (TLE2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products