SM22 alpha (TAGLN) (NM_001001522) Human Mass Spec Standard

SKU
PH302448
TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_001001522)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202448]
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC202448 protein sequence
Red=Cloning site Green=Tags(s)

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001522
RefSeq Size 1574
RefSeq ORF 603
Synonyms SM22; SM22-alpha; SMCC; TAGLN1; WS3-10
Locus ID 6876
UniProt ID Q01995
Cytogenetics 11q23.3
Summary This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
PH315789 TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177) 10 ug
$3,255.00
LC401104 TAGLN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424369 TAGLN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401104 Transient overexpression lysate of transgelin (TAGLN), transcript variant 2 100 ug
$436.00
LY424369 Transient overexpression lysate of transgelin (TAGLN), transcript variant 1 100 ug
$436.00
TP302448 Recombinant protein of human transgelin (TAGLN), transcript variant 1, 20 µg 20 ug
$737.00
TP315789 Recombinant protein of human transgelin (TAGLN), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.