KCNK6 (NM_004823) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202421] |
Predicted MW | 33.7 kDa |
Protein Sequence |
Protein Sequence
>RC202421 protein sequence
Red=Cloning site Green=Tags(s) MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN ADEDDRVDILGPQPESHQQLSASSHTDYASIPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004814 |
RefSeq Size | 2671 |
RefSeq ORF | 939 |
Synonyms | K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2 |
Locus ID | 9424 |
UniProt ID | Q9Y257 |
Cytogenetics | 19q13.2 |
Summary | This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401515 | KCNK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401515 | Transient overexpression lysate of potassium channel, subfamily K, member 6 (KCNK6) | 100 ug |
$436.00
|
|
TP302421 | Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.