OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMS1 (PYCARD) (NM_145183) Human Mass Spec Standard

Be the first to review this product
SKU
PH302409
PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660184)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800081 PYCARD (TMS1) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9) 100 ul
$447.00
LY408042 Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "TMS1 or NM_145183"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202409
Predicted MW 15 kDa
Protein Sequence
Protein Sequence
>RC202409 protein sequence
Red=Cloning site Green=Tags(s)

MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVE
WLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660184
RefSeq Size 763
RefSeq ORF 405
Synonyms apoptosis-associated speck-like protein containing a CARD; ASC; ASC, TMS1, CARD5, MGC10332; CARD5; caspase recruitment domain protein 5; MGC10332; PYD and CARD domain containing; target of methylation-induced silencing-1; TMS; TMS-1; TMS1
Locus ID 29108
UniProt ID Q9ULZ3
Cytogenetics 16p11.2
Summary This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMS1" proteins (9)
SKU Description Size Price
PH315592 PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390) 10 ug
$3,360.00
PH324051 PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660183) 10 ug
$3,360.00
LC402233 Lyophilized PYCARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408042 Lyophilized PYCARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402233 Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408042 Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302409 Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 3, 20 µg 20 ug
$867.00
TP315592 Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 1, 20 µg 20 ug
$867.00
TP324051 Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products