TMS1 (PYCARD) (NM_145183) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202409] |
Predicted MW | 15 kDa |
Protein Sequence |
Protein Sequence
>RC202409 protein sequence
Red=Cloning site Green=Tags(s) MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVE WLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_660184 |
RefSeq Size | 763 |
RefSeq ORF | 405 |
Synonyms | apoptosis-associated speck-like protein containing a CARD; ASC; ASC, TMS1, CARD5, MGC10332; CARD5; caspase recruitment domain protein 5; MGC10332; PYD and CARD domain containing; target of methylation-induced silencing-1; TMS; TMS-1; TMS1 |
Locus ID | 29108 |
UniProt ID | Q9ULZ3 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315592 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390) | 10 ug |
$3,255.00
|
|
PH324051 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660183) | 10 ug |
$3,255.00
|
|
LC402233 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408042 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402233 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 1 | 100 ug |
$436.00
|
|
LY408042 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 3 | 100 ug |
$436.00
|
|
TP302409 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP315592 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP324051 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.