UCK2 (NM_012474) Human Mass Spec Standard

SKU
PH302406
UCK2 MS Standard C13 and N15-labeled recombinant protein (NP_036606)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202406]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC202406 protein sequence
Red=Cloning site Green=Tags(s)

MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS
EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036606
RefSeq Size 4940
RefSeq ORF 783
Synonyms TSA903; UK; UMPK
Locus ID 7371
UniProt ID Q9BZX2
Cytogenetics 1q24.1
Summary This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.[provided by RefSeq, Oct 2010]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:UCK2 (NM_012474) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402221 UCK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402221 Transient overexpression lysate of uridine-cytidine kinase 2 (UCK2) 100 ug
$436.00
TP302406 Recombinant protein of human uridine-cytidine kinase 2 (UCK2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.