GOLPH3L (NM_018178) Human Mass Spec Standard

SKU
PH302398
GOLPH3L MS Standard C13 and N15-labeled recombinant protein (NP_060648)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202398]
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC202398 protein sequence
Red=Cloning site Green=Tags(s)

MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC
ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE
LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER
WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA
AFNKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060648
RefSeq Size 3208
RefSeq ORF 855
Synonyms GPP34R
Locus ID 55204
UniProt ID Q9H4A5
Cytogenetics 1q21.3
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GOLPH3L (NM_018178) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413097 GOLPH3L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413097 Transient overexpression lysate of golgi phosphoprotein 3-like (GOLPH3L) 100 ug
$436.00
TP302398 Recombinant protein of human golgi phosphoprotein 3-like (GOLPH3L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.