Cytochrome b5 (CYB5A) (NM_148923) Human Mass Spec Standard

SKU PH302378

CYB5A MS Standard C13 and N15-labeled recombinant protein (NP_683725)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202378]
• Predicted MW: 15.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC202378 protein sequence; Red=Cloning site Green=Tags(s); ; MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST; DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_683725
• RefSeq Size: 850
• RefSeq ORF: 402
• Synonyms: CYB5; MCB5; METAG
• Locus ID: 1528
• UniProt ID: P00167
• Cytogenetics: 18q22.3
• Summary: The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
• Protein Families: Transmembrane