LSM6 (NM_007080) Human Mass Spec Standard

SKU PH302373

LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202373]
• Predicted MW: 9.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC202373 protein sequence; Red=Cloning site Green=Tags(s); ; MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV; LYISTQKRRM; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_009011
• RefSeq Size: 789
• RefSeq ORF: 240
• Synonyms: YDR378C
• Locus ID: 11157
• UniProt ID: P62312
• Cytogenetics: 4q31.22
• Summary: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation, Spliceosome