SQOR (NM_021199) Human Mass Spec Standard

SKU
PH302335
SQRDL MS Standard C13 and N15-labeled recombinant protein (NP_067022)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202335]
Predicted MW 50 kDa
Protein Sequence
Protein Sequence
>RC202335 protein sequence
Red=Cloning site Green=Tags(s)

MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN
VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY
LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY
LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK
PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA
AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067022
RefSeq Size 2003
RefSeq ORF 1350
Synonyms CGI-44; PRO1975; SQR; SQRDL
Locus ID 58472
UniProt ID Q9Y6N5
Cytogenetics 15q21.1
Summary The protein encoded by this gene may function in mitochondria to catalyze the conversion of sulfide to persulfides, thereby decreasing toxic concencrations of sulfide. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SQOR (NM_021199) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412038 SQRDL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412038 Transient overexpression lysate of sulfide quinone reductase-like (yeast) (SQRDL), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP302335 Recombinant protein of human sulfide quinone reductase-like (yeast) (SQRDL), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.