PBLD (NM_022129) Human Mass Spec Standard

SKU
PH302328
PBLD MS Standard C13 and N15-labeled recombinant protein (NP_071412)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202328]
Predicted MW 31.8 kDa
Protein Sequence
Protein Sequence
>RC202328 protein sequence
Red=Cloning site Green=Tags(s)

MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF
TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI
KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA
FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV
VLEGTLTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071412
RefSeq Size 2587
RefSeq ORF 864
Synonyms HEL-S-306; MAWBP; MAWDBP
Locus ID 64081
UniProt ID P30039
Cytogenetics 10q21.3
Write Your Own Review
You're reviewing:PBLD (NM_022129) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411757 PBLD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411757 Transient overexpression lysate of phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1 100 ug
$436.00
TP302328 Recombinant protein of human phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720507 Recombinant protein of human phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.