DIMT1L (DIMT1) (NM_014473) Human Mass Spec Standard

SKU
PH302326
DIMT1L MS Standard C13 and N15-labeled recombinant protein (NP_055288)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202326]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC202326 protein sequence
Red=Cloning site Green=Tags(s)

MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNM
TVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFK
LLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIE
PKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQIL
TSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055288
RefSeq Size 1557
RefSeq ORF 939
Synonyms DIM1; DIMT1L; HSA9761; HUSSY5
Locus ID 27292
UniProt ID Q9UNQ2
Cytogenetics 5q12.1
Summary The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:DIMT1L (DIMT1) (NM_014473) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415255 DIMT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415255 Transient overexpression lysate of DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) (DIMT1L) 100 ug
$436.00
TP302326 Recombinant protein of human DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) (DIMT1L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.