LRTOMT (NM_145309) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202297] |
Predicted MW | 22.2 kDa |
Protein Sequence |
Protein Sequence
>RC202297 protein sequence
Red=Cloning site Green=Tags(s) MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_660352 |
RefSeq Size | 2658 |
RefSeq ORF | 576 |
Locus ID | 220074 |
UniProt ID | Q96E66 |
Cytogenetics | 11q13.4 |
Summary | This locus represents naturally occurring readthrough transcription between the neighboring LRRC51 (leucine-rich repeat containing 51) and TOMT (transmembrane O-methyltransferase) genes on chromosome 11. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. Multiple reports implicate mutations in this gene in nonsyndromic deafness.[provided by RefSeq, Feb 2021] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC407958 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428810 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428811 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407958 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1 | 100 ug |
$436.00
|
|
LY428810 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 2 | 100 ug |
$436.00
|
|
LY428811 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 4 | 100 ug |
$436.00
|
|
TP302297 | Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.