LRTOMT (NM_145309) Human Mass Spec Standard

SKU
PH302297
LRTOMT MS Standard C13 and N15-labeled recombinant protein (NP_660352)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202297]
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC202297 protein sequence
Red=Cloning site Green=Tags(s)

MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV
ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME
EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660352
RefSeq Size 2658
RefSeq ORF 576
Locus ID 220074
UniProt ID Q96E66
Cytogenetics 11q13.4
Summary This locus represents naturally occurring readthrough transcription between the neighboring LRRC51 (leucine-rich repeat containing 51) and TOMT (transmembrane O-methyltransferase) genes on chromosome 11. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. Multiple reports implicate mutations in this gene in nonsyndromic deafness.[provided by RefSeq, Feb 2021]
Write Your Own Review
You're reviewing:LRTOMT (NM_145309) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407958 LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428810 LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428811 LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407958 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1 100 ug
$436.00
LY428810 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 2 100 ug
$436.00
LY428811 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 4 100 ug
$436.00
TP302297 Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.