PSMD6 (NM_014814) Human Mass Spec Standard

SKU
PH302292
PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202292]
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC202292 representing NM_014814
Red=Cloning site Green=Tags(s)

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL
NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI
VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS
YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ
EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV
NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055629
RefSeq Size 1308
RefSeq ORF 1167
Synonyms p42A; p44S10; Rpn7; S10; SGA-113M
Locus ID 9861
UniProt ID Q15008
Cytogenetics 3p14.1
Summary This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
Protein Pathways Proteasome
Write Your Own Review
You're reviewing:PSMD6 (NM_014814) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415023 PSMD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415023 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6) 100 ug
$436.00
TP302292 Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.