OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAP1 (MOAP1) (NM_022151) Human Mass Spec Standard

Be the first to review this product
SKU
PH302203
MOAP1 MS Standard C13 and N15-labeled recombinant protein (NP_071434)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306095 Rabbit Polyclonal MAP1 Antibody
100 ug
$640.00
LY411739 Transient overexpression lysate of modulator of apoptosis 1 (MOAP1) (as WB positive control) 100 ug
$436.00

Other products for "MAP1 or NM_022151"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202203
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC202203 protein sequence
Red=Cloning site Green=Tags(s)

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF
T

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071434
RefSeq Size 2435
RefSeq ORF 1053
Synonyms MAP-1; PNMA4
Locus ID 64112
UniProt ID Q96BY2
Cytogenetics 14q32.12
Summary The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAP1" proteins (3)
SKU Description Size Price
LC411739 Lyophilized MOAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411739 Transient overexpression lysate of modulator of apoptosis 1 (MOAP1) (as WB positive control) 100 ug
$436.00
TP302203 Recombinant protein of human modulator of apoptosis 1 (MOAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products