MAP1 (MOAP1) (NM_022151) Human Mass Spec Standard

SKU
PH302203
MOAP1 MS Standard C13 and N15-labeled recombinant protein (NP_071434)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202203]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC202203 protein sequence
Red=Cloning site Green=Tags(s)

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF
T

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071434
RefSeq Size 2435
RefSeq ORF 1053
Synonyms MAP-1; PNMA4
Locus ID 64112
UniProt ID Q96BY2
Cytogenetics 14q32.12
Summary The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MAP1 (MOAP1) (NM_022151) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411739 MOAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411739 Transient overexpression lysate of modulator of apoptosis 1 (MOAP1) 100 ug
$436.00
TP302203 Recombinant protein of human modulator of apoptosis 1 (MOAP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.