Cystathionase (CTH) (NM_001902) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202195] |
Predicted MW | 44.5 kDa |
Protein Sequence |
Protein Sequence
>RC202195 protein sequence
Red=Cloning site Green=Tags(s) MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001893 |
RefSeq Size | 2140 |
RefSeq ORF | 1215 |
Locus ID | 1491 |
UniProt ID | P32929 |
Cytogenetics | 1p31.1 |
Summary | This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010] |
Protein Pathways | Cysteine and methionine metabolism, Glycine, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism, serine and threonine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC419669 | CTH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434190 | CTH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419669 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 | 100 ug |
$436.00
|
|
LY434190 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3 | 100 ug |
$436.00
|
|
TP302195 | Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.