Cystathionase (CTH) (NM_001902) Human Mass Spec Standard

SKU
PH302195
CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202195]
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC202195 protein sequence
Red=Cloning site Green=Tags(s)

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA
TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001893
RefSeq Size 2140
RefSeq ORF 1215
Locus ID 1491
UniProt ID P32929
Cytogenetics 1p31.1
Summary This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]
Protein Pathways Cysteine and methionine metabolism, Glycine, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism, serine and threonine metabolism
Write Your Own Review
You're reviewing:Cystathionase (CTH) (NM_001902) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419669 CTH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434190 CTH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419669 Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 100 ug
$436.00
LY434190 Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3 100 ug
$436.00
TP302195 Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.