GCIP interacting protein p29 (SYF2) (NM_015484) Human Mass Spec Standard

SKU
PH302167
SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202167]
Predicted MW 28.7 kDa
Protein Sequence
Protein Sequence
>RC202167 protein sequence
Red=Cloning site Green=Tags(s)

MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA
KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK
QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY
INERNAKFNKKAERFYGKYTAEIKQNLERGTAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056299
RefSeq Size 1777
RefSeq ORF 729
Synonyms CBPIN; fSAP29; NTC31; P29
Locus ID 25949
UniProt ID O95926
Cytogenetics 1p36.11
Summary This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:GCIP interacting protein p29 (SYF2) (NM_015484) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404061 SYF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414518 SYF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404061 Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 2 100 ug
$436.00
LY414518 Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1 100 ug
$436.00
TP302167 Recombinant protein of human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.