ACTR3B (NM_020445) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202148] |
Predicted MW | 47.6 kDa |
Protein Sequence |
Protein Sequence
>RC202148 protein sequence
Red=Cloning site Green=Tags(s) MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_065178 |
RefSeq Size | 2223 |
RefSeq ORF | 1254 |
Synonyms | ARP3BETA; ARP11 |
Locus ID | 57180 |
UniProt ID | Q9P1U1 |
Cytogenetics | 7q36.1-q36.2 |
Summary | This gene encodes a member of the actin-related proteins (ARP), which form multiprotein complexes and share 35-55% amino acid identity with conventional actin. The protein encoded by this gene may have a regulatory role in the actin cytoskeleton and induce cell-shape change and motility. Pseudogenes of this gene are located on chromosomes 2, 4, 10, 16, 22 and Y. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC412453 | ACTR3B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421689 | ACTR3B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412453 | Transient overexpression lysate of ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1 | 100 ug |
$436.00
|
|
LY421689 | Transient overexpression lysate of ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 2 | 100 ug |
$436.00
|
|
TP302148 | Recombinant protein of human ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.