IRF2 (NM_002199) Human Mass Spec Standard

SKU
PH302102
IRF2 MS Standard C13 and N15-labeled recombinant protein (NP_002190)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202102]
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC202102 protein sequence
Red=Cloning site Green=Tags(s)

MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVD
KPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP
VESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESD
EQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASF
VTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002190
RefSeq Size 2302
RefSeq ORF 1047
Synonyms IRF-2
Locus ID 3660
UniProt ID P14316
Cytogenetics 4q35.1
Summary IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:IRF2 (NM_002199) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400800 IRF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400800 Transient overexpression lysate of interferon regulatory factor 2 (IRF2) 100 ug
$436.00
TP302102 Recombinant protein of human interferon regulatory factor 2 (IRF2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710148 Recombinant protein of human interferon regulatory factor 2 (IRF2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.