MOCS3 (NM_014484) Human Mass Spec Standard

SKU
PH302099
MOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_055299)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202099]
Predicted MW 49.5 kDa
Protein Sequence
Protein Sequence
>RC202099 representing NM_014484
Red=Cloning site Green=Tags(s)

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLP
ELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFS
AAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEG
QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDA
LRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF
HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK
AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055299
RefSeq Size 2458
RefSeq ORF 1380
Synonyms UBA4
Locus ID 27304
UniProt ID O95396
Cytogenetics 20q13.13
Summary Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq, Nov 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:MOCS3 (NM_014484) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415243 MOCS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415243 Transient overexpression lysate of molybdenum cofactor synthesis 3 (MOCS3) 100 ug
$436.00
TP302099 Recombinant protein of human molybdenum cofactor synthesis 3 (MOCS3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.