OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOCS3 (NM_014484) Human Mass Spec Standard

Be the first to review this product
SKU
PH302099
MOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_055299)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365862 MOCS3 rabbit polyclonal antibody
100 ul
$310.00
LY415243 Transient overexpression lysate of molybdenum cofactor synthesis 3 (MOCS3) (as WB positive control) 100 ug
$436.00

Other products for "MOCS3 or NM_014484"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202099
Predicted MW 49.5 kDa
Protein Sequence
Protein Sequence
>RC202099 representing NM_014484
Red=Cloning site Green=Tags(s)

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLP
ELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFS
AAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEG
QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDA
LRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF
HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK
AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055299
RefSeq Size 2458
RefSeq ORF 1380
Synonyms UBA4
Locus ID 27304
UniProt ID O95396
Cytogenetics 20q13.13
Summary Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. provided by RefSeq, Nov 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOCS3" proteins (3)
SKU Description Size Price
LC415243 Lyophilized MOCS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415243 Transient overexpression lysate of molybdenum cofactor synthesis 3 (MOCS3) (as WB positive control) 100 ug
$436.00
TP302099 Recombinant protein of human molybdenum cofactor synthesis 3 (MOCS3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products