Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Mass Spec Standard

SKU
PH302081
CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001020365)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202081]
Predicted MW 62.3 kDa
Protein Sequence
Protein Sequence
>RC202081 protein sequence
Red=Cloning site Green=Tags(s)

MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP
AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH
GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG
NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA
VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI
NKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI
ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIR
LSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ
TEHIEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020365
RefSeq Size 2024
RefSeq ORF 1698
Synonyms ACAT; CE-1; CEH; CES2; hCE-1; HMSE; HMSE1; PCE-1; REH; SES1; TGH
Locus ID 1066
UniProt ID P23141
Cytogenetics 16q12.2
Summary This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
Write Your Own Review
You're reviewing:Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320398 CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001257) 10 ug
$3,255.00
PH320445 CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001020366) 10 ug
$3,255.00
LC400509 CES1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422599 CES1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422600 CES1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400509 Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 3 100 ug
$436.00
LY422599 Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2 100 ug
$436.00
LY422600 Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 1 100 ug
$665.00
TP302081 Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2, 20 µg 20 ug
$737.00
TP320398 Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 3, 20 µg 20 ug
$737.00
TP320445 Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 1, 20 µg 20 ug
$737.00
TP720377 Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.