IL8 (CXCL8) (NM_000584) Human Mass Spec Standard

SKU
PH302075
IL8 MS Standard C13 and N15-labeled recombinant protein (NP_000575)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202075]
Predicted MW 11.1 kDa
Protein Sequence
Protein Sequence
>RC202075 representing NM_000584
Red=Cloning site Green=Tags(s)

MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL
SDGRELCLDPKENWVQRVVEKFLKRAENS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000575
RefSeq Size 1666
RefSeq ORF 297
Synonyms GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1; SCYB8
Locus ID 3576
UniProt ID P10145
Cytogenetics 4q13.3
Summary The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, May 2020]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Bladder cancer, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IL8 (CXCL8) (NM_000584) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400198 CXCL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400198 Transient overexpression lysate of interleukin 8 (IL8) 100 ug
$436.00
TP302075 Recombinant protein of human interleukin 8 (IL8), 20 µg 20 ug
$867.00
TP701252 Purified recombinant protein of Human interleukin 8 (IL8), expressed in HEK293 cells, full length, with C-terminal His tag, secretory expressed in HEK293 cells, 100ug 100 ug
$867.00
TP720027 Recombinant protein of human interleukin 8 (IL8) 10 ug
$260.00
TP720029 Recombinant protein of human interleukin 8 (IL8) 10 ug
$260.00
TP721122 Purified recombinant protein of Human interleukin 8 (IL8) 10 ug
$250.00
TP723733 Purified recombinant protein of Human interleukin 8 (IL8) 10 ug
$345.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.