Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard

SKU
PH302043
GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202043]
Predicted MW 52 kDa
Protein Sequence
Protein Sequence
>RC202043 protein sequence
Red=Cloning site Green=Tags(s)

MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSAD
YIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFV
FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSA
KVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTL
CRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIAC
PETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDL
AVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073324
RefSeq Size 3318
RefSeq ORF 1410
Synonyms GN-2; GN2
Locus ID 8908
UniProt ID O15488
Cytogenetics Xp22.33
Summary This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421559 GYG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433068 GYG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421559 Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 1 100 ug
$436.00
LY433068 Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 4 100 ug
$436.00
TP302043 Recombinant protein of human glycogenin 2 (GYG2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP330068 Recombinant protein of human glycogenin 2 (GYG2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.