OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDCD6 (NM_013232) Human Mass Spec Standard

Be the first to review this product
SKU
PH302030
PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324255 Anti-PDCD6 rabbit polyclonal antibody
100 ul
$305.00
LY415726 Transient overexpression lysate of programmed cell death 6 (PDCD6) (as WB positive control) 100 ug
$436.00

Other products for "PDCD6 or NM_013232"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202030
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC202030 protein sequence
Red=Cloning site Green=Tags(s)

MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR
QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037364
RefSeq Size 1151
RefSeq ORF 573
Synonyms ALG-2; ALG2; PEF1B
Locus ID 10016
UniProt ID O75340
Cytogenetics 5p15.33
Summary This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. provided by RefSeq, May 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDCD6" proteins (3)
SKU Description Size Price
LC415726 Lyophilized PDCD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415726 Transient overexpression lysate of programmed cell death 6 (PDCD6) (as WB positive control) 100 ug
$436.00
TP302030 Recombinant protein of human programmed cell death 6 (PDCD6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products