SSBP2 (NM_012446) Human Mass Spec Standard

SKU
PH301947
SSBP2 MS Standard C13 and N15-labeled recombinant protein (NP_036578)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201947]
Predicted MW 37.8 kDa
Protein Sequence
Protein Sequence
>RC201947 protein sequence
Red=Cloning site Green=Tags(s)

MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWD
LYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLR
IPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPG
MNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPN
RPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQS
ESYSPSMTMSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036578
RefSeq Size 4441
RefSeq ORF 1083
Synonyms HSPC116; SOSS-B2
Locus ID 23635
UniProt ID P81877
Cytogenetics 5q14.1
Summary This gene encodes a subunit of a protein complex that interacts with single-stranded DNA and is involved in the DNA damage response and maintenance of genome stability. The encoded protein may also play a role in telomere repair. A variant of this gene may be associated with survival in human glioblastoma patients. [provided by RefSeq, Sep 2016]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SSBP2 (NM_012446) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402214 SSBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402214 Transient overexpression lysate of single-stranded DNA binding protein 2 (SSBP2) 100 ug
$436.00
TP301947 Recombinant protein of human single-stranded DNA binding protein 2 (SSBP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.