Calretinin (CALB2) (NM_001740) Human Mass Spec Standard

SKU PH301924

CALB2 MS Standard C13 and N15-labeled recombinant protein (NP_001731)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201924]
• Predicted MW: 31.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC201924 protein sequence; Red=Cloning site Green=Tags(s); ; MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKE; FMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSTEFMEAWRKYDTDRSGYIEANELKGFLSDLL; KKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKD; RSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001731
• RefSeq Size: 1485
• RefSeq ORF: 813
• Synonyms: CAB29; CAL2; CR
• Locus ID: 794
• UniProt ID: P22676
• Cytogenetics: 16q22.2
• Summary: This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]