HDAC11 (NM_024827) Human Mass Spec Standard

SKU
PH301919
HDAC11 MS Standard C13 and N15-labeled recombinant protein (NP_079103)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201919]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC201919 protein sequence
Red=Cloning site Green=Tags(s)

MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED
LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG
FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP
GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK
RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079103
RefSeq Size 2918
RefSeq ORF 1041
Synonyms HD11
Locus ID 79885
UniProt ID Q96DB2
Cytogenetics 3p25.1
Summary This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HDAC11 (NM_024827) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403040 HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427788 HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403040 Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 1 100 ug
$436.00
LY427788 Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 2 100 ug
$436.00
TP301919 Recombinant protein of human histone deacetylase 11 (HDAC11), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.