CLN6 (NM_017882) Human Mass Spec Standard

SKU
PH301904
CLN6 MS Standard C13 and N15-labeled recombinant protein (NP_060352)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201904]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC201904 protein sequence
Red=Cloning site Green=Tags(s)

MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFP
LEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFS
GYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTASKAESLIPGPA
LLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFLFSSFALTLLLVALWVAWL
WNDPVLRKKYPGVIYVPEPWAFYTLHVSSRH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060352
RefSeq Size 2258
RefSeq ORF 933
Synonyms CLN4A; HsT18960; nclf
Locus ID 54982
UniProt ID Q9NWW5
Cytogenetics 15q23
Summary This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. [provided by RefSeq, Oct 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CLN6 (NM_017882) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402624 CLN6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402624 Transient overexpression lysate of ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6) 100 ug
$436.00
TP301904 Recombinant protein of human ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.