TDP1 (NM_001008744) Human Mass Spec Standard

SKU
PH301888
TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008744)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201888]
Predicted MW 68.4 kDa
Protein Sequence
Protein Sequence
>RC201888 protein sequence
Red=Cloning site Green=Tags(s)

MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS
VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE
EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW
LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH
TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET
NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA
MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF
AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008744
RefSeq Size 3540
RefSeq ORF 1824
Locus ID 55775
UniProt ID Q9NUW8
Cytogenetics 14q32.11
Summary The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:TDP1 (NM_001008744) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314927 TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_060789) 10 ug
$3,255.00
LC413162 TDP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423370 TDP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413162 Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1 100 ug
$436.00
LY423370 Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2 100 ug
$436.00
TP301888 Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314927 Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.