Ephrin B1 (EFNB1) (NM_004429) Human Mass Spec Standard

SKU
PH301886
EFNB1 MS Standard C13 and N15-labeled recombinant protein (NP_004420)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201886]
Predicted MW 38 kDa
Protein Sequence
Protein Sequence
>RC201886 protein sequence
Red=Cloning site Green=Tags(s)

MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG
RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG
SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE
TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL
SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004420
RefSeq Size 3344
RefSeq ORF 1038
Synonyms CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Locus ID 1947
UniProt ID P98172
Cytogenetics Xq13.1
Summary The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:Ephrin B1 (EFNB1) (NM_004429) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401409 EFNB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401409 Transient overexpression lysate of ephrin-B1 (EFNB1) 100 ug
$436.00
TP301886 Recombinant protein of human ephrin-B1 (EFNB1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721089 Purified recombinant protein of Human ephrin-B1 (EFNB1) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.