UBAP1 (NM_016525) Human Mass Spec Standard

SKU
PH301858
UBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057609)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201858]
Predicted MW 55.1 kDa
Protein Sequence
Protein Sequence
>RC201858 protein sequence
Red=Cloning site Green=Tags(s)

MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK
KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT
KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ
DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT
AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT
EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN
ALEDLMARAGAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057609
RefSeq Size 2743
RefSeq ORF 1506
Synonyms NAG20; SPG80; UAP; UBAP; UBAP-1
Locus ID 51271
UniProt ID Q9NZ09
Cytogenetics 9p13.3
Summary This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:UBAP1 (NM_016525) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402559 UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433186 UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433285 UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402559 Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 1 100 ug
$436.00
LY433186 Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 2 100 ug
$436.00
LY433285 Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 4 100 ug
$436.00
TP301858 Recombinant protein of human ubiquitin associated protein 1 (UBAP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.