Asparagine synthetase (ASNS) (NM_183356) Human Mass Spec Standard

SKU
PH301838
ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201838]
Predicted MW 64.4 kDa
Protein Sequence
Protein Sequence
>RC201838 protein sequence
Red=Cloning site Green=Tags(s)

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL
WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY
GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDE
PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK
YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE
HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK
A

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899199
RefSeq Size 2362
RefSeq ORF 1683
Synonyms ASNSD; TS11
Locus ID 440
UniProt ID P08243
Cytogenetics 7q21.3
Summary The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism
Write Your Own Review
You're reviewing:Asparagine synthetase (ASNS) (NM_183356) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301297 ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664) 10 ug
$3,255.00
PH315380 ASNS MS Standard C13 and N15-labeled recombinant protein (NP_597680) 10 ug
$3,255.00
LC403336 ASNS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405247 ASNS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419813 ASNS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403336 Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1 100 ug
$436.00
LY405247 Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 100 ug
$436.00
LY419813 Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 2 100 ug
$436.00
TP301297 Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP301838 Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315380 Recombinant protein of human asparagine synthetase (ASNS), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.