UBOX5 (NM_014948) Human Mass Spec Standard

SKU
PH301812
UBOX5 MS Standard C13 and N15-labeled recombinant protein (NP_055763)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201812]
Predicted MW 59 kDa
Protein Sequence
Protein Sequence
>RC201812 protein sequence
Red=Cloning site Green=Tags(s)

MVINLCLPQFRPRIHCNKISADGYEVENLISEDLTKRSHGFRTEYFIKPPVYVTVSFPFNVEICRINIDL
TAGGGQNVTGLEMYTSASSSRVSWNTPQCRTLGPAEPSVPDKEAFTLVGKVLLKNQSQVVFSHRGFKARP
PFGAMEATLPSPAVVAQELWNKGALSLSHVAHLRICITHVTGGGIPCIKRLEVWGQPAKTCSQEVIDSIL
LVTSENLPQDVALQAPALPMESDCDPGDQPESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPS
GKVIDQSTLEKCNRSEATWGRVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTAL
AVIPSSIVLPSQKRKIEQAEHVPDSNFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGP
LSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSNTSWRPGTGSEQPGSILGPECASCKRVF
SPYFKKEPVYQLPCGHLLCRPCLGEKQRSLPMTCTACQRPVASQDVLRVHF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055763
RefSeq Size 4362
RefSeq ORF 1623
Synonyms hUIP5; RNF37; UBCE7IP5; UIP5
Locus ID 22888
UniProt ID O94941
Cytogenetics 20p13
Summary This gene encodes a U-box domain containing protein. The encoded protein interacts with E2 enzymes and may play a role in the ubiquitination pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBOX5 (NM_014948) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414914 UBOX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414914 Transient overexpression lysate of U-box domain containing 5 (UBOX5), transcript variant 1 100 ug
$436.00
TP301812 Recombinant protein of human U-box domain containing 5 (UBOX5), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.