PPOX (NM_000309) Human Mass Spec Standard

SKU
PH301788
PPOX MS Standard C13 and N15-labeled recombinant protein (NP_000300)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201788]
Predicted MW 50.8 kDa
Protein Sequence
Protein Sequence
>RC201788 protein sequence
Red=Cloning site Green=Tags(s)

MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGAR
TLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGK
EPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLGLLLGAGRTPQ
PDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEAD
HVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS
VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000300
RefSeq Size 1716
RefSeq ORF 1431
Synonyms PPO; V290M; VP
Locus ID 5498
UniProt ID P50336
Cytogenetics 1q23.3
Summary This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Porphyrin and chlorophyll metabolism
Write Your Own Review
You're reviewing:PPOX (NM_000309) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325811 PPOX MS Standard C13 and N15-labeled recombinant protein (NP_001116236) 10 ug
$3,255.00
LC424808 PPOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426558 PPOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424808 Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY426558 Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
TP301788 Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$737.00
TP325811 Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.